Recombinant Human ANGEL2 protein, GST-tagged

• Cat.No.: ANGEL2-549H
• Product Overview: Human ANGEL2 full-length ORF ( AAH47469.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANGEL2 (Angel Homolog 2) is a Protein Coding gene. An important paralog of this gene is ANGEL1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 58.8 kDa
• AA Sequence: MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANGEL2 angel homolog 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: ANGEL2
• Synonyms: ANGEL2; angel homolog 2 (Drosophila); protein angel homolog 2; FLJ12793; KIAA0759L
• Gene ID: 90806
• mRNA Refseq: NM_144567
• Protein Refseq: NP_653168
• UniProt ID: Q5VTE6