Recombinant Human ANGEL2 protein, GST-tagged

Cat.No. : ANGEL2-549H
Product Overview : Human ANGEL2 full-length ORF ( AAH47469.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANGEL2 (Angel Homolog 2) is a Protein Coding gene. An important paralog of this gene is ANGEL1.
Molecular Mass : 58.8 kDa
AA Sequence : MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANGEL2 angel homolog 2 (Drosophila) [ Homo sapiens ]
Official Symbol ANGEL2
Synonyms ANGEL2; angel homolog 2 (Drosophila); protein angel homolog 2; FLJ12793; KIAA0759L;
Gene ID 90806
mRNA Refseq NM_144567
Protein Refseq NP_653168
UniProt ID Q5VTE6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANGEL2 Products

Required fields are marked with *

My Review for All ANGEL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon