Recombinant Human ANGEL2 protein, GST-tagged
Cat.No. : | ANGEL2-549H |
Product Overview : | Human ANGEL2 full-length ORF ( AAH47469.1, 1 a.a. - 286 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | ANGEL2 (Angel Homolog 2) is a Protein Coding gene. An important paralog of this gene is ANGEL1. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 58.8 kDa |
AA Sequence : | MSYNILSQDLLEDNSHLYRHCRRPVLHWSFRFPNILKEIKHFDADVLCLQEVQEDHYGAEIRPSLESLGYHCEYKMRTGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSVPGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIWPPNLGISQNCVYEVQQVPKVEKTDSDLTQTQLKQTEVLVTAEKLSSNLQHHFSLSSVY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANGEL2 angel homolog 2 (Drosophila) [ Homo sapiens ] |
Official Symbol | ANGEL2 |
Synonyms | ANGEL2; angel homolog 2 (Drosophila); protein angel homolog 2; FLJ12793; KIAA0759L; |
Gene ID | 90806 |
mRNA Refseq | NM_144567 |
Protein Refseq | NP_653168 |
UniProt ID | Q5VTE6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ANGEL2 Products
Required fields are marked with *
My Review for All ANGEL2 Products
Required fields are marked with *
0
Inquiry Basket