Recombinant Human ANAPC13 protein, His-tagged

• Cat.No.: ANAPC13-543H
• Product Overview: Human ANAPC13 (NP_056206, 1 a.a. - 74 a.a.? ) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Description: This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq, Nov 2008]
• Source: E. coli
• Species: Human
• Tag: His
• Form: Liquid
• Molecular Mass: 10 kDa
• AA Sequence: MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
• Purity: > 90% by SDS - PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT, 0.1M NaCl).

Gene Information

• Gene Name: ANAPC13 anaphase promoting complex subunit 13 [ Homo sapiens ]
• Official Symbol: ANAPC13
• Synonyms: ANAPC13; anaphase promoting complex subunit 13; anaphase-promoting complex subunit 13; APC13; DKFZP566D193; SWM1; cyclosome subunit 13; DKFZp566D193
• Gene ID: 25847
• mRNA Refseq: NM_001242374
• Protein Refseq: NP_001229303
• MIM: 614484
• UniProt ID: Q9BS18