Recombinant Human ANAPC13 protein, His-tagged
Cat.No. : | ANAPC13-543H |
Product Overview : | Human ANAPC13 (NP_056206, 1 a.a. - 74 a.a.? ) full-length recombinant protein with His tag expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq, Nov 2008] |
Form : | Liquid |
Molecular Mass : | 10 kDa |
AA Sequence : | MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN |
Purity : | > 90% by SDS - PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT, 0.1M NaCl). |
Gene Name | ANAPC13 anaphase promoting complex subunit 13 [ Homo sapiens ] |
Official Symbol | ANAPC13 |
Synonyms | ANAPC13; anaphase promoting complex subunit 13; anaphase-promoting complex subunit 13; APC13; DKFZP566D193; SWM1; cyclosome subunit 13; DKFZp566D193; |
Gene ID | 25847 |
mRNA Refseq | NM_001242374 |
Protein Refseq | NP_001229303 |
MIM | 614484 |
UniProt ID | Q9BS18 |
◆ Recombinant Proteins | ||
ANAPC13-147R | Recombinant Rhesus Macaque ANAPC13 Protein, His (Fc)-Avi-tagged | +Inquiry |
ANAPC13-8522Z | Recombinant Zebrafish ANAPC13 | +Inquiry |
ANAPC13-319R | Recombinant Rhesus monkey ANAPC13 Protein, His-tagged | +Inquiry |
ANAPC13-543H | Recombinant Human ANAPC13 protein, His-tagged | +Inquiry |
ANAPC13-4877C | Recombinant Chicken ANAPC13 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC13-8867HCL | Recombinant Human ANAPC13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ANAPC13 Products
Required fields are marked with *
My Review for All ANAPC13 Products
Required fields are marked with *
0
Inquiry Basket