Recombinant Human ANAPC10 protein, GST-tagged

Cat.No. : ANAPC10-541H
Product Overview : Human ANAPC10 full-length ORF ( AAH05217.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]
Molecular Mass : 47.7 kDa
AA Sequence : MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens ]
Official Symbol ANAPC10
Synonyms ANAPC10; anaphase promoting complex subunit 10; anaphase-promoting complex subunit 10; APC10; DKFZP564L0562; DOC1; cyclosome subunit 10; DKFZp564L0562;
Gene ID 10393
mRNA Refseq NM_001256706
Protein Refseq NP_001243635
MIM 613745
UniProt ID Q9UM13

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ANAPC10 Products

Required fields are marked with *

My Review for All ANAPC10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon