Recombinant Human ANAPC10 protein, GST-tagged

• Cat.No.: ANAPC10-541H
• Product Overview: Human ANAPC10 full-length ORF ( AAH05217.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.7 kDa
• AA Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens ]
• Official Symbol: ANAPC10
• Synonyms: ANAPC10; anaphase promoting complex subunit 10; anaphase-promoting complex subunit 10; APC10; DKFZP564L0562; DOC1; cyclosome subunit 10; DKFZp564L0562
• Gene ID: 10393
• mRNA Refseq: NM_001256706
• Protein Refseq: NP_001243635
• MIM: 613745
• UniProt ID: Q9UM13