Recombinant Human AMZ1 protein, GST-tagged

• Cat.No.: AMZ1-537H
• Product Overview: Human AMZ1 full-length ORF (BAG52482.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AMZ1 (Archaelysin Family Metallopeptidase 1) is a Protein Coding gene. GO annotations related to this gene include metallopeptidase activity. An important paralog of this gene is AMZ2.
• Molecular Mass: 58.3 kDa
• AA Sequence: MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLAEAYNPQRTLFCTLLIRTGFDWLLSRPEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASIRCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHGHVPRALPPSGPGELPLAPLPHAGCAQPGRGPAAAPGPLSHLPEEAAACPGFQAHREVPETLHLDSGGGGDVAQPGGGGAVSVGGHPACQRRLGHVL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AMZ1 archaelysin family metallopeptidase 1 [ Homo sapiens ]
• Official Symbol: AMZ1
• Synonyms: AMZ1; archaelysin family metallopeptidase 1; archaemetzincin-1; archaemetzincin 1; KIAA1950; metalloproteinase-like protein; archeobacterial metalloproteinase-like protein 1
• Gene ID: 155185
• mRNA Refseq: NM_133463
• Protein Refseq: NP_597720
• MIM: 615168
• UniProt ID: Q400G9