Recombinant Human Amyloid-Beta 1-40 Protein, 15N Label

• Cat.No.: ABN-301H
• Product Overview: Recombinant Human Amyloid-Beta 1-40 Protein, 15N Uniform Label is expressed in Escherichia coli using 15NH4-Cl as sole nitrogen source. Counter Ion: Ammonium Acetate.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• ProteinLength: 1-40 a.a.
• Form: Lyophilized
• AA Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
• Purity: > 95% HPLC and SDS-PAGE
• Storage: Store at -20 centigrade upon arrival.
• Reconstitution: To efficiently solubilise the amyloid β-peptide (1-40) the pH should briefly be raised to between 11-12. This can be accomplished by 20 mM of NaOH, however, at high peptide concentrations a higher NaOH concentration may be required due to the intrinsic buffering capacity of the peptide. The pH should therefore always be monitored and if necessary adjusted. After solubilisation the pH can be adjusted using the buffer of choice.