Recombinant Human AMT protein, GST-tagged
Cat.No. : | AMT-301238H |
Product Overview : | Recombinant Human AMT (147-321 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Val147-Met321 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | EKDLALMQDKVRELQNQGRDVGLEVLDNALLALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGAVHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAMDFPGAKVIVPQLKGRVQRRRVGLM |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | AMT aminomethyltransferase [ Homo sapiens ] |
Official Symbol | AMT |
Synonyms | AMT; aminomethyltransferase; aminomethyltransferase (glycine cleavage system protein T); aminomethyltransferase, mitochondrial; GCST; glycine cleavage system protein T; NKH; glycine cleavage system T protein; GCE; GCVT; |
Gene ID | 275 |
mRNA Refseq | NM_000481 |
Protein Refseq | NP_000472 |
MIM | 238310 |
UniProt ID | P48728 |
◆ Recombinant Proteins | ||
Amt-1617M | Recombinant Mouse Amt Protein, Myc/DDK-tagged | +Inquiry |
AMT-45C | Recombinant Cynomolgus Monkey AMT Protein, His (Fc)-Avi-tagged | +Inquiry |
AMT-144R | Recombinant Rhesus Macaque AMT Protein, His (Fc)-Avi-tagged | +Inquiry |
AMT-301238H | Recombinant Human AMT protein, GST-tagged | +Inquiry |
AMT-3425H | Recombinant Human AMT, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AMT-72HCL | Recombinant Human AMT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMT Products
Required fields are marked with *
My Review for All AMT Products
Required fields are marked with *
0
Inquiry Basket