Recombinant Human ALYREF protein, GST-tagged
Cat.No. : | ALYREF-512H |
Product Overview : | Human ALYREF full-length ORF (AAH52302.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 54.67 kDa |
AA Sequence : | MADKMDMSLDDIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAYNARMDTS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALYREF Aly/REF export factor [ Homo sapiens ] |
Official Symbol | ALYREF |
Synonyms | ALY; BEF; REF; THOC4; ALY/REF |
Gene ID | 10189 |
mRNA Refseq | NM_005782.3 |
Protein Refseq | NP_005773.3 |
MIM | 604171 |
UniProt ID | Q86V81 |
◆ Recombinant Proteins | ||
ALYREF-1114HF | Recombinant Full Length Human ALYREF Protein, GST-tagged | +Inquiry |
ALYREF-512H | Recombinant Human ALYREF protein, GST-tagged | +Inquiry |
ALYREF-1584M | Recombinant Mouse ALYREF Protein | +Inquiry |
ALYREF-5987Z | Recombinant Zebrafish ALYREF | +Inquiry |
ALYREF-496M | Recombinant Mouse ALYREF Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALYREF Products
Required fields are marked with *
My Review for All ALYREF Products
Required fields are marked with *
0
Inquiry Basket