Recombinant Human ALYREF Protein(11-250aa), MBP&His-tagged

• Cat.No.: ALYREF-9607H
• Product Overview: Recombinant Human ALYREF Protein(11-250aa)(Q86V81), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-MBP & C-His
• Protein length: 11-250aa
• Form: 0.15 M Phosphate buffered saline.
• AA Sequence: DIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAY
• Storage: Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ALYREF Aly/REF export factor [ Homo sapiens ]
• Official Symbol: ALYREF
• Synonyms: Aly/REF export factor; Ally of AML-1 and LEF-1; ALY; Transcriptional coactivator Aly/REF; BEF; bZIP-enhancing factor BEF; THOC4; bZIP enhancing factor; ALY/REF; THO complex subunit 4; REF; tho4; THO complex 4; Tho4
• Gene ID: 10189
• mRNA Refseq: NM_005782
• Protein Refseq: NP_005773
• MIM: 604171
• UniProt ID: Q86V81