Recombinant Human ALYREF Protein(11-250aa), MBP&His-tagged
Cat.No. : | ALYREF-9607H |
Product Overview : | Recombinant Human ALYREF Protein(11-250aa)(Q86V81), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&MBP |
Protein Length : | 11-250aa |
Form : | 0.15 M Phosphate buffered saline. |
AA Sequence : | DIIKLNRSQRGGRGGGRGRGRAGSQGGRGGGAQAAARVNRGGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVETGGKLLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQLVTSQIDAQRRPAQSVNRGGMTRNRGAGGFGGGGGTRRGTRGGARGRGRGAGRNSKQQLSAEELDAQLDAY |
Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | ALYREF Aly/REF export factor [ Homo sapiens ] |
Official Symbol | ALYREF |
Synonyms | Aly/REF export factor; Ally of AML-1 and LEF-1; ALY; Transcriptional coactivator Aly/REF; BEF; bZIP-enhancing factor BEF; THOC4; bZIP enhancing factor; ALY/REF; THO complex subunit 4; REF; tho4; THO complex 4; Tho4 |
Gene ID | 10189 |
mRNA Refseq | NM_005782 |
Protein Refseq | NP_005773 |
MIM | 604171 |
UniProt ID | Q86V81 |
◆ Recombinant Proteins | ||
ALYREF-1114HF | Recombinant Full Length Human ALYREF Protein, GST-tagged | +Inquiry |
ALYREF-5987Z | Recombinant Zebrafish ALYREF | +Inquiry |
ALYREF-9607H | Recombinant Human ALYREF Protein(11-250aa), MBP&His-tagged | +Inquiry |
ALYREF-9606H | Recombinant Human ALYREF Protein(11-250aa), His-tagged | +Inquiry |
ALYREF-5241C | Recombinant Chicken ALYREF | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALYREF Products
Required fields are marked with *
My Review for All ALYREF Products
Required fields are marked with *
0
Inquiry Basket