Recombinant Human ALX3 protein, GST-tagged

• Cat.No.: ALX3-510H
• Product Overview: Human ALX3 partial ORF ( NP_006483, 150 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a nuclear protein with a homeobox DNA-binding domain that functions as a transcriptional regulator involved in cell-type differentiation and development. Preferential methylation of this gene's promoter is associated with advanced-stage neuroblastoma tumors. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALX3 ALX homeobox 3 [ Homo sapiens ]
• Official Symbol: ALX3
• Synonyms: ALX3; ALX homeobox 3; aristaless like homeobox 3; homeobox protein aristaless-like 3; aristaless-like homeobox 3; proline-rich transcription factor ALX3; FND1; MGC138212; MGC141988
• Gene ID: 257
• mRNA Refseq: NM_006492
• Protein Refseq: NP_006483
• MIM: 606014
• UniProt ID: O95076