Recombinant Human ALPK2 Protein, GST-tagged

• Cat.No.: ALPK2-492H
• Product Overview: Human ALPK2 partial ORF ( NP_443179, 201 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: ALPK2 (Alpha Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.73 kDa
• AA Sequence: DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALPK2 alpha-kinase 2 [ Homo sapiens ]
• Official Symbol: ALPK2
• Synonyms: ALPK2; alpha-kinase 2; alpha-protein kinase 2; HAK; heart alpha kinase; heart alpha-kinase; heart alpha-protein kinase; FLJ34875; FLJ43253
• Gene ID: 115701
• mRNA Refseq: NM_052947
• Protein Refseq: NP_443179
• UniProt ID: Q86TB3