Recombinant Human ALPK2 Protein, GST-tagged

Cat.No. : ALPK2-492H
Product Overview : Human ALPK2 partial ORF ( NP_443179, 201 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ALPK2 (Alpha Kinase 2) is a Protein Coding gene. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein serine/threonine kinase activity. An important paralog of this gene is ALPK3.
Molecular Mass : 37.73 kDa
AA Sequence : DGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFASDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQPGMKGNP
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ALPK2 alpha-kinase 2 [ Homo sapiens ]
Official Symbol ALPK2
Synonyms ALPK2; alpha-kinase 2; alpha-protein kinase 2; HAK; heart alpha kinase; heart alpha-kinase; heart alpha-protein kinase; FLJ34875; FLJ43253;
Gene ID 115701
mRNA Refseq NM_052947
Protein Refseq NP_443179
UniProt ID Q86TB3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ALPK2 Products

Required fields are marked with *

My Review for All ALPK2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon