Recombinant Human ALPK1 Protein, GST-tagged

• Cat.No.: ALPK1-491H
• Product Overview: Human ALPK1 partial ORF ( NP_079420.2, 1147 a.a. - 1242 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an alpha kinase. Mice which were homozygous for disrupted copies of this gene exhibited coordination defects (PMID: 21208416). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.3 kDa
• AA Sequence: VVKTEYKATEYGLAYGHFSYEFSNHRDVVVDLQGWVTGNGKGLIYLTDPQIHSVDQKVFTTNFGKRGIFYFFNNQHVECNEICHRLSLTRPSMEKP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALPK1 alpha-kinase 1 [ Homo sapiens ]
• Official Symbol: ALPK1
• Synonyms: ALPK1; alpha-kinase 1; alpha-protein kinase 1; FLJ22670; KIAA1527; Lak; lymphocyte alpha kinase; chromosome 4 kinase; lymphocyte alpha-kinase; lymphocyte alpha-protein kinase; LAK; 8430410J10Rik
• Gene ID: 80216
• mRNA Refseq: NM_001102406
• Protein Refseq: NP_001095876
• MIM: 607347
• UniProt ID: Q96QP1