Recombinant Human ALOX5AP Full Length Transmembrane protein (1-161 aa), His-SUMO-tagged

• Cat.No.: ALOX5AP-2725H
• Product Overview: Recombinant Human ALOX5AP Protein (1-161 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-161aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 34.2 kDa
• AA Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ]
• Official Symbol: ALOX5AP
• Synonyms: ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein
• Gene ID: 241
• mRNA Refseq: NM_001204406
• Protein Refseq: NP_001191335
• MIM: 603700
• UniProt ID: P20292