Recombinant Human ALOX5AP Protein, GST-tagged

• Cat.No.: ALOX5AP-488H
• Product Overview: Human ALOX5AP full-length ORF ( AAH18538, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2011]
• Molecular Mass: 43.45 kDa
• AA Sequence: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALOX5AP arachidonate 5-lipoxygenase-activating protein [ Homo sapiens ]
• Official Symbol: ALOX5AP
• Synonyms: ALOX5AP; arachidonate 5-lipoxygenase-activating protein; five lipoxygenase activating protein; FLAP; MK 886 binding protein; MK-886-binding protein
• Gene ID: 241
• mRNA Refseq: NM_001204406
• Protein Refseq: NP_001191335
• MIM: 603700
• UniProt ID: P20292