Recombinant Human ALOX5 protein, His-tagged
Cat.No. : | ALOX5-5744H |
Product Overview : | Recombinant Human ALOX5 protein(1-349 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-349 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLARDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVLNYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNGCNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDPCTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWL |
Gene Name | ALOX5 arachidonate 5-lipoxygenase [ Homo sapiens ] |
Official Symbol | ALOX5 |
Synonyms | ALOX5; arachidonate 5-lipoxygenase; 5 LOX; leukotriene A4 synthase; arachidonic acid 5-lipoxygenase; arachidonic 5-lipoxygenase alpha-10 isoform; arachidonic 5-lipoxygenase delta-13 isoform; arachidonic 5-lipoxygenase delta-p10 isoform; arachidonic 5-lipoxygenase delta-10-13 isoform; 5-LO; 5LPG; LOG5; 5-LOX; MGC163204; |
Gene ID | 240 |
mRNA Refseq | NM_000698 |
Protein Refseq | NP_000689 |
MIM | 152390 |
UniProt ID | P09917 |
◆ Recombinant Proteins | ||
HMOX1-023H | Recombinant Human HMOX1 Protein, His-tagged | +Inquiry |
HMOX1-5723H | Recombinant Human HMOX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Hmox1-1141M | Recombinant Mouse Hmox1 Protein, MYC/DDK-tagged | +Inquiry |
HMOX1-3083H | Recombinant Human HMOX1 Protein (Leu61-Ile172), N-His tagged | +Inquiry |
HMOX1-2493R | Recombinant Rat HMOX1 Protein (1-289 aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HMOX1-5467HCL | Recombinant Human HMOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HMOX1 Products
Required fields are marked with *
My Review for All HMOX1 Products
Required fields are marked with *
0
Inquiry Basket