Recombinant Human ALKBH6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ALKBH6-2492H |
Product Overview : | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 17.8 kDa |
AA Sequence : | MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMHHQPGLPHRAGLLRAAAARGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ALKBH6 alkB homolog 6 [ Homo sapiens (human) ] |
Official Symbol | ALKBH6 |
Synonyms | alkB, alkylation repair homolog 6 (E. coli); alkylation repair homolog 6; probable alpha-ketoglutarate-dependent dioxygenase ABH6; Alkylated DNA repair protein alkB homolog 6; EC 1.14.11.; MGC15677; ALKBH6 |
Gene ID | 84964 |
mRNA Refseq | NM_198867 |
Protein Refseq | NP_942567 |
MIM | 613304 |
UniProt ID | Q3KRA9 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ALKBH6 Products
Required fields are marked with *
My Review for All ALKBH6 Products
Required fields are marked with *
0
Inquiry Basket