Recombinant Human ALKBH6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ALKBH6-2492H
• Product Overview: ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 17.8 kDa
• AA Sequence: MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMHHQPGLPHRAGLLRAAAARGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ALKBH6 alkB homolog 6 [ Homo sapiens (human) ]
• Official Symbol: ALKBH6
• Synonyms: alkB, alkylation repair homolog 6 (E. coli); alkylation repair homolog 6; probable alpha-ketoglutarate-dependent dioxygenase ABH6; Alkylated DNA repair protein alkB homolog 6; EC 1.14.11.; MGC15677; ALKBH6
• Gene ID: 84964
• mRNA Refseq: NM_198867
• Protein Refseq: NP_942567
• MIM: 613304
• UniProt ID: Q3KRA9