Recombinant Human ALG13 protein, GST-tagged

• Cat.No.: ALG13-9574H
• Product Overview: Recombinant Human ALG13 protein(NP_001034299)(1-165 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-165 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• AA Sequence: MKCVFVTVGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPGQPEKFSAFLDKVVGLQK
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: ALG13 asparagine-linked glycosylation 13 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG13
• Synonyms: ALG13; asparagine-linked glycosylation 13 homolog (S. cerevisiae); chromosome X open reading frame 45 , CXorf45, GLT28D1, glycosyltransferase 28 domain containing 1; UDP-N-acetylglucosamine transferase subunit ALG13 homolog; FLJ23018; MDS031; YGL047W; glycosyltransferase 28 domain-containing protein 1; hematopoietic stem/progenitor cells protein MDS031; CXorf45; GLT28D1; FLJ31785; MGC12423
• Gene ID: 79868
• mRNA Refseq: NM_001039210
• Protein Refseq: NP_001034299
• MIM: 300776
• UniProt ID: Q9NP73