Recombinant Human ALG12 Protein, GST-tagged

• Cat.No.: ALG12-461H
• Product Overview: Human ALG12 partial ORF ( NP_077010, 369 a.a. - 425 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 32.01 kDa
• AA Sequence: NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALG12 asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: ALG12
• Synonyms: ALG12; asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase homolog (S. cerevisiae); asparagine linked glycosylation 12 homolog (yeast, alpha 1,6 mannosyltransferase); dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; ECM39; membrane protein SB87; mannosyltransferase ALG12 homolog; asparagine-linked glycosylation protein 12 homolog; dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; dolichyl-P-mannose:Man-7-GlcNAc-2-PP-dolichyl-alpha-6-mannosyltransferase; asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase); asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase); CDG1G; hALG12; PP14673; MGC3136; MGC111358
• Gene ID: 79087
• mRNA Refseq: NM_024105
• Protein Refseq: NP_077010
• MIM: 607144
• UniProt ID: Q9BV10