Recombinant Human ALG10 Protein, GST-tagged

• Cat.No.: ALG10-460H
• Product Overview: Human ALG10 partial ORF ( NP_116223, 48 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel. [provided by RefSeq, Jan 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 31.24 kDa
• AA Sequence: KLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALG10 asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe) [ Homo sapiens ]
• Official Symbol: ALG10
• Synonyms: ALG10; asparagine-linked glycosylation 10, alpha-1,2-glucosyltransferase homolog (S. pombe); asparagine linked glycosylation 10, alpha 1,2 glucosyltransferase homolog (yeast); dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase; derepression of ITR1 expression 2 homolog (S. cerevisiae); DIE2; FLJ14751; alpha2-glucosyltransferase; potassium channel regulator 1; alpha-2-glucosyltransferase ALG10-A; alpha-1,2-glucosyltransferase ALG10-A; derepression of ITR1 expression 2 homolog; asparagine-linked glycosylation protein 10 homolog A; asparagine-linked glycosylation 10 homolog (yeast, alpha-1,2-glucosyltransferase); KCR1
• Gene ID: 84920
• mRNA Refseq: NM_032834
• Protein Refseq: NP_116223
• MIM: 603313
• UniProt ID: Q5BKT4