Recombinant Human ALDOA

Cat.No. : ALDOA-26497TH
Product Overview : Recombinant full length Human Aldolase expressed in Saccharomyces cerevisiae; 364 amino acids, MWt 39.4 kDa. Protein is tagged with 26 kDa proprietary tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Non
Description : The protein encoded by this gene, Aldolase A (fructose-bisphosphate aldolase), is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing and alternative promoter usage results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 3 and 10.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSI AKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVI LFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGE HTPSALAIMENANVLARYASICQQNGIVPIVEPEILPD GDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMV TPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLS GGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASA LKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAG AAASESLFVSNHAY
Full Length : Full L.
Gene Name ALDOA aldolase A, fructose-bisphosphate [ Homo sapiens ]
Official Symbol ALDOA
Synonyms ALDOA; aldolase A, fructose-bisphosphate; fructose-bisphosphate aldolase A;
Gene ID 226
mRNA Refseq NM_000034
Protein Refseq NP_000025
MIM 103850
Uniprot ID P04075
Chromosome Location 16p11.2
Pathway Fructose and mannose metabolism, organism-specific biosystem; Fructose and mannose metabolism, conserved biosystem; Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem;
Function actin binding; cytoskeletal protein binding; fructose binding; fructose-bisphosphate aldolase activity; identical protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ALDOA Products

Required fields are marked with *

My Review for All ALDOA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon