Recombinant Human ALDH5A1, His-tagged
Cat.No. : | ALDH5A1-26496TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 109-535 of Human ALDH5A1 with an N terminal His tag. Observed mwt: 56 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 109-535 a.a. |
Description : | This protein belongs to the aldehyde dehydrogenase family of proteins. This gene encodes a mitochondrial NAD(+)-dependent succinic semialdehyde dehydrogenase. A deficiency of this enzyme, known as 4-hydroxybutyricaciduria, is a rare inborn error in the metabolism of the neurotransmitter 4-aminobutyric acid (GABA). In response to the defect, physiologic fluids from patients accumulate GHB, a compound with numerous neuromodulatory properties. Two transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Tissue specificity : | Brain, pancreas, heart, liver, skeletal muscle and kidney. Lower in placenta. |
Form : | Lyophilised:Reconstitute with 114 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FCRWREVSAKERSSLLRKWYNLMIQNKDDLARIITAESGK PLKEAHGEILYSAFFLEWFSEEARRVYGDIIHTPAKDR RALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALALAELASQAGIPSGVYNVIPCSRKNA KEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSVKR VSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAFAEAMKKNLRVGNGFEEGTTQ GPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKN FFEPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWRVAEQLEVGMVGVNEGL ISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGG L |
Sequence Similarities : | Belongs to the aldehyde dehydrogenase family. |
Gene Name | ALDH5A1 aldehyde dehydrogenase 5 family, member A1 [ Homo sapiens ] |
Official Symbol | ALDH5A1 |
Synonyms | ALDH5A1; aldehyde dehydrogenase 5 family, member A1; succinate-semialdehyde dehydrogenase, mitochondrial; SSADH; SSDH; succinate semialdehyde dehydrogenase; |
Gene ID | 7915 |
mRNA Refseq | NM_001080 |
Protein Refseq | NP_001071 |
MIM | 610045 |
Uniprot ID | P51649 |
Chromosome Location | 6p22 |
Pathway | Alanine, aspartate and glutamate metabolism, organism-specific biosystem; Alanine, aspartate and glutamate metabolism, conserved biosystem; Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; Degradation of GABA, organism-specific biosystem; |
Function | oxidoreductase activity; protein homodimerization activity; succinate-semialdehyde dehydrogenase activity; succinate-semialdehyde dehydrogenase activity; |
◆ Recombinant Proteins | ||
ALDH5A1-6188Z | Recombinant Zebrafish ALDH5A1 | +Inquiry |
ALDH5A1-26496TH | Recombinant Human ALDH5A1, His-tagged | +Inquiry |
ALDH5A1-2508H | Recombinant Human ALDH5A1 protein, His-SUMO-tagged | +Inquiry |
ALDH5A1-1324H | Recombinant Human ALDH5A1 Protein (48-535 aa), His-tagged | +Inquiry |
ALDH5A1-2821H | Recombinant Human ALDH5A1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH5A1-60HCL | Recombinant Human ALDH5A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDH5A1 Products
Required fields are marked with *
My Review for All ALDH5A1 Products
Required fields are marked with *
0
Inquiry Basket