Recombinant Human ALDH3B2 protein, His-tagged
Cat.No. : | ALDH3B2-498H |
Product Overview : | Recombinant Human ALDH3B2 protein(92-385 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 92-385 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | TGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGCGRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINWQEKPLALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL |
Gene Name | ALDH3B2 aldehyde dehydrogenase 3 family, member B2 [ Homo sapiens ] |
Official Symbol | ALDH3B2 |
Synonyms | ALDH3B2; aldehyde dehydrogenase 3 family, member B2; ALDH8; aldehyde dehydrogenase family 3 member B2; acetaldehyde dehydrogenase 8; aldehyde dehydrogenase 8; |
Gene ID | 222 |
mRNA Refseq | NM_000695 |
Protein Refseq | NP_000686 |
MIM | 601917 |
UniProt ID | P48448 |
◆ Recombinant Proteins | ||
AAMP-12190Z | Recombinant Zebrafish AAMP | +Inquiry |
AAMP-1542HFL | Recombinant Full Length Human AAMP Protein, C-Flag-tagged | +Inquiry |
AAMP-019H | Recombinant Human AAMP Protein, GST-tagged | +Inquiry |
AAMP-3580C | Recombinant Chicken AAMP | +Inquiry |
Aamp-1452M | Recombinant Mouse Aamp Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AAMP-9157HCL | Recombinant Human AAMP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AAMP Products
Required fields are marked with *
My Review for All AAMP Products
Required fields are marked with *
0
Inquiry Basket