Recombinant Human ALDH2 Protein, GST-tagged
Cat.No. : | ALDH2-444H |
Product Overview : | Human ALDH2 partial ORF ( AAH02967, 408 a.a. - 517 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of East Asians have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among East Asians than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Nov 2016] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ALDH2 aldehyde dehydrogenase 2 family (mitochondrial) [ Homo sapiens ] |
Official Symbol | ALDH2 |
Synonyms | ALDH2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH class 2; liver mitochondrial ALDH; acetaldehyde dehydrogenase 2; nucleus-encoded mitochondrial aldehyde dehydrogenase 2; ALDM; ALDHI; ALDH-E2; MGC1806; |
Gene ID | 217 |
mRNA Refseq | NM_000690 |
Protein Refseq | NP_000681 |
MIM | 100650 |
UniProt ID | P05091 |
◆ Recombinant Proteins | ||
ALDH2-131H | Recombinant Human ALDH2 protein, GST-tagged | +Inquiry |
ALDH2-3508HFL | Recombinant Full Length Human ALDH2 protein, Flag-tagged | +Inquiry |
ALDH2-0564H | Recombinant Human ALDH2 Protein (Full Length), N-His-tagged | +Inquiry |
Aldh2-2422R | Recombinant Rat Aldh2 protein, His&Myc-tagged | +Inquiry |
ALDH2-620R | Recombinant Rat ALDH2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ALDH2-8918HCL | Recombinant Human ALDH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ALDH2 Products
Required fields are marked with *
My Review for All ALDH2 Products
Required fields are marked with *
0
Inquiry Basket