Recombinant Human ALDH2 protein, GST-tagged

• Cat.No.: ALDH2-131H
• Product Overview: Recombinant Human ALDH2(1 a.a. - 517 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of aldehyde dehydrogenase, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have the cytosolic isozyme but not the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of a catalytically active form of the mitochondrial isozyme. The increased exposure to acetaldehyde in individuals with the catalytically inactive form may also confer greater susceptibility to many types of cancer. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 82.8 kDa
• Protein length: 1 a.a. - 517 a.a.
• AA Sequence: MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKED VDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYA GWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLI KEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYIN TGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFT KDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: ALDH2 aldehyde dehydrogenase 2 family (mitochondrial) [ Homo sapiens ]
• Official Symbol: ALDH2
• Synonyms: ALDH2; aldehyde dehydrogenase 2 family (mitochondrial); aldehyde dehydrogenase, mitochondrial; ALDH class 2; liver mitochondrial ALDH; acetaldehyde dehydrogenase 2; nucleus-encoded mitochondrial aldehyde dehydrogenase 2; ALDM; ALDHI; ALDH-E2; MGC1806
• Gene ID: 217
• mRNA Refseq: NM_000690
• Protein Refseq: NP_000681
• MIM: 100650
• UniProt ID: P05091
• Chromosome Location: 12q24.12
• Pathway: Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Ascorbate and aldarate metabolism, organism-specific biosystem; Ascorbate and aldarate metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Ethanol oxidation, organism-specific biosystem; Fatty Acid Omega Oxidation, organism-specific biosystem
• Function: aldehyde dehydrogenase (NAD) activity; aldehyde dehydrogenase [NAD(P)+] activity; electron carrier activity; oxidoreductase activity