Recombinant Human AKR7A2 Protein, GST-tagged

• Cat.No.: AKR7A2-176H
• Product Overview: Recombinant Human AKR7A2 Protien(NP_003680)(60-359 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 60-359 aa
• AA Sequence: RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: AKR7A2 aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase) [ Homo sapiens ]
• Official Symbol: AKR7A2
• Synonyms: AKR7A2; aldo-keto reductase family 7, member A2 (aflatoxin aldehyde reductase); aflatoxin B1 aldehyde reductase member 2; AFAR; AFB1-AR 1; SSA reductase; aldoketoreductase 7; AFB1 aldehyde reductase 1; succinic semialdehyde reductase; aflatoxin beta1 aldehyde reductase; AKR7; AFAR1; AFB1-AR1
• Gene ID: 8574
• mRNA Refseq: NM_003689
• Protein Refseq: NP_003680
• MIM: 603418
• UniProt ID: O43488