Recombinant Human AKR1C2
Cat.No. : | AKR1C2-27158TH |
Product Overview : | Recombinant full length Human AKR1C2 with N terminal proprietary tag, MW: 61.53 kDa inclusive of tag. P52895, AAH07024. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 323 amino acids |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. |
Molecular Weight : | 61.530kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKL AIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS DEY |
Sequence Similarities : | Belongs to the aldo/keto reductase family. |
Gene Name | AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ] |
Official Symbol | AKR1C2 |
Synonyms | AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; |
Gene ID | 1646 |
mRNA Refseq | NM_001135241 |
Protein Refseq | NP_001128713 |
MIM | 600450 |
Uniprot ID | P52895 |
Chromosome Location | 10p15-p14 |
Pathway | Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem; |
Function | androsterone dehydrogenase (A-specific) activity; bile acid binding; carboxylic acid binding; oxidoreductase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity; |
◆ Recombinant Proteins | ||
AKR1C2-2502H | Recombinant Human AKR1C2 protein, His-SUMO-tagged | +Inquiry |
AKR1C2-255R | Recombinant Rat AKR1C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C2-18H | Recombinant Human AKR1C2, MYC/DDK-tagged | +Inquiry |
AKR1C2-1367HF | Recombinant Full Length Human AKR1C2 Protein, GST-tagged | +Inquiry |
AKR1C2-412H | Recombinant Human AKR1C2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1C2 Products
Required fields are marked with *
My Review for All AKR1C2 Products
Required fields are marked with *
0
Inquiry Basket