Recombinant Human AKR1C2

• Cat.No.: AKR1C2-27158TH
• Product Overview: Recombinant full length Human AKR1C2 with N terminal proprietary tag, MW: 61.53 kDa inclusive of tag. P52895, AAH07024.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
• Protein length: 323 amino acids
• Molecular Weight: 61.530kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKL AIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIF YTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLA KSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQR KLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFS DEY
• Sequence Similarities: Belongs to the aldo/keto reductase family.
• Tag: Non

Gene Information

• Gene Name: AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ]
• Official Symbol: AKR1C2
• Synonyms: AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2
• Gene ID: 1646
• mRNA Refseq: NM_001135241
• Protein Refseq: NP_001128713
• MIM: 600450
• Uniprot ID: P52895
• Chromosome Location: 10p15-p14
• Pathway: Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem
• Function: androsterone dehydrogenase (A-specific) activity; bile acid binding; carboxylic acid binding; oxidoreductase activity; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase activity