Recombinant Human AKIRIN2 Protein, GST-Tagged

• Cat.No.: AKIRIN2-0011H
• Product Overview: Human C6orf166 full-length ORF (AAH00764, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: AKIRIN2 (Akirin 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is AKIRIN1.
• Molecular Mass: 48.07 kDa
• AA Sequence: MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AKIRIN2 akirin 2 [ Homo sapiens ]
• Official Symbol: AKIRIN2
• Synonyms: AKIRIN2; akirin 2; C6orf166, chromosome 6 open reading frame 166; akirin-2; dJ486L4.2; FLJ10342; fourteen-three-three beta interactant 1; FBI1; C6orf166
• Gene ID: 55122
• mRNA Refseq: NM_018064
• Protein Refseq: NP_060534
• MIM: 615165
• UniProt ID: Q53H80