Recombinant Human AKAP7 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | AKAP7-101H |
Product Overview : | AKAP7 MS Standard C13 and N15-labeled recombinant protein (NP_004833) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 8.8 kDa |
AA Sequence : | MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | AKAP7 A-kinase anchoring protein 7 [ Homo sapiens (human) ] |
Official Symbol | AKAP7 |
Synonyms | AKAP7; A-kinase anchoring protein 7; AKAP15; AKAP18; A-kinase anchoring protein 7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 18 kDa; A-kinase anchor protein 9 kDa; AKAP 18 |
Gene ID | 9465 |
mRNA Refseq | NM_004842 |
Protein Refseq | NP_004833 |
MIM | 604693 |
UniProt ID | O43687 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All AKAP7 Products
Required fields are marked with *
My Review for All AKAP7 Products
Required fields are marked with *
0
Inquiry Basket