Recombinant Human AKAP7 protein, GST-tagged

• Cat.No.: AKAP7-9524H
• Product Overview: Recombinant Human AKAP7 protein(1-81 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: HIV1
• Source: E.coli
• Tag: GST
• Protein Length: 1-81 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

Gene Information

• Gene Name: AKAP7 A kinase (PRKA) anchor protein 7 [ Homo sapiens ]
• Official Symbol: AKAP7
• Synonyms: AKAP7; A kinase (PRKA) anchor protein 7; A-kinase anchor protein 7 isoform gamma; AKAP15; AKAP18; AKAP 18; PRKA7 isoform gamma; AKAP-7 isoform gamma; PRKA7 isoforms alpha/beta; A-kinase anchor protein 9 kDa; A-kinase anchor protein 18 kDa; AKAP-7 isoforms alpha and beta; A-kinase anchor protein 7 isoforms alpha and beta
• Gene ID: 9465
• mRNA Refseq: NM_004842
• Protein Refseq: NP_004833
• MIM: 604693
• UniProt ID: O43687