Recombinant Human AK3 protein, GST-tagged

• Cat.No.: AK3-301589H
• Product Overview: Recombinant Human AK3 (1-227 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Met1-Pro227
• AA Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: AK3 adenylate kinase 3 [ Homo sapiens ]
• Official Symbol: AK3
• Synonyms: AK3; adenylate kinase 3; adenylate kinase 3 like 1 , adenylate kinase 6 , AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L
• Gene ID: 50808
• mRNA Refseq: NM_001199852
• Protein Refseq: NP_001186781
• MIM: 609290
• UniProt ID: Q9UIJ7