Recombinant Human AK3 Protein, GST-tagged

• Cat.No.: AK3-486H
• Product Overview: Human AK3 full-length ORF ( NP_057366.2, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a GTP:ATP phosphotransferase that is found in the mitochondrial matrix. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]
• Molecular Mass: 52 kDa
• AA Sequence: MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AK3 adenylate kinase 3 [ Homo sapiens ]
• Official Symbol: AK3
• Synonyms: AK3; adenylate kinase 3; adenylate kinase 3 like 1, adenylate kinase 6, AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L
• Gene ID: 50808
• mRNA Refseq: NM_001199852
• Protein Refseq: NP_001186781
• MIM: 609290
• UniProt ID: Q9UIJ7