Recombinant Human AK1 Protein, GST-tagged

• Cat.No.: AK1-483H
• Product Overview: Human AK1 full-length ORF ( AAH01116, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 47.08 kDa
• AA Sequence: MEEKLKKTNIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AK1 adenylate kinase 1 [ Homo sapiens ]
• Official Symbol: AK1
• Synonyms: AK1; adenylate kinase 1; adenylate kinase isoenzyme 1; AK 1; myokinase; ATP-AMP transphosphorylase 1
• Gene ID: 203
• mRNA Refseq: NM_000476
• Protein Refseq: NP_000467
• MIM: 103000
• UniProt ID: P00568