Recombinant Human AIG1 Protein, GST-tagged
Cat.No. : | AIFM3-475H |
Product Overview : | Human AIFM3 full-length ORF ( NP_001018070.1, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | AIFM3 (Apoptosis Inducing Factor, Mitochondria Associated 3) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and 2 iron, 2 sulfur cluster binding. An important paralog of this gene is AIFM1. |
Molecular Mass : | 92.4 kDa |
AA Sequence : | MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AIFM3 apoptosis-inducing factor, mitochondrion-associated, 3 [ Homo sapiens ] |
Official Symbol | AIFM3 |
Synonyms | AIFM3; apoptosis-inducing factor, mitochondrion-associated, 3; apoptosis-inducing factor 3; AIFL; FLJ30473; apoptosis-inducing factor like; FLJ45137; |
Gene ID | 150209 |
mRNA Refseq | NM_001018060 |
Protein Refseq | NP_001018070 |
MIM | 617298 |
UniProt ID | Q96NN9 |
◆ Recombinant Proteins | ||
AIFM3-957HF | Recombinant Full Length Human AIFM3 Protein, GST-tagged | +Inquiry |
AIFM3-2699H | Recombinant Human AIFM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AIFM3-413M | Recombinant Mouse AIFM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AIFM3-6904Z | Recombinant Zebrafish AIFM3 | +Inquiry |
AIFM3-475H | Recombinant Human AIG1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIFM3-8952HCL | Recombinant Human AIFM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AIFM3 Products
Required fields are marked with *
My Review for All AIFM3 Products
Required fields are marked with *
0
Inquiry Basket