Recombinant Human AIG1 Protein, GST-tagged

• Cat.No.: AIFM3-475H
• Product Overview: Human AIFM3 full-length ORF ( NP_001018070.1, 1 a.a. - 598 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AIFM3 (Apoptosis Inducing Factor, Mitochondria Associated 3) is a Protein Coding gene. GO annotations related to this gene include oxidoreductase activity and 2 iron, 2 sulfur cluster binding. An important paralog of this gene is AIFM1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 92.4 kDa
• AA Sequence: MGGCFSKPKPVELKIEVVLPEKERGKEELSASGKGSPRAYQGNGTARHFHTEERLSTPHPYPSPQDCVEAAVCHVKDLENGQMREVELGWGKVLLVKDNGEFHALGHKCPHYGAPLVKGVLSRGRVRCPWHGACFNISTGDLEDFPGLDSLHKFQVKIEKEKVYVRASKQALQLQRRTKVMAKCISPSAGYSSSTNVLIVGAGAAGLVCAETLRQEGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVLTEAQVVTVDVRTKKVVFKDGFKLEYSKLLLAPGSSPKTLSCKGKEVENVFTIRTPEDANRVVRLARGRNVVVVGAGFLGMEVAAYLTEKAHSVSVVELEETPFRRFLGERVGRALMKMFENNRVKFYMQTEVSELRGQEGKLKEVVLKSSKVVRADVCVVGIGAVPATGFLRQSGIGLDSRGFIPVNKMMQTNVPGVFAAGDAVTFPLAWRNNRKVNIPHWQMAHAQGRVAAQNMLAQEAEMSTVPYLWTAMFGKSLRYAGYGEGFDDVIIQGDLEELKFVAFYTKGDEVIAVASMNYDPIVSKVAEVLASGRAIRKREVETGDMSWLTGKGS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AIFM3 apoptosis-inducing factor, mitochondrion-associated, 3 [ Homo sapiens ]
• Official Symbol: AIFM3
• Synonyms: AIFM3; apoptosis-inducing factor, mitochondrion-associated, 3; apoptosis-inducing factor 3; AIFL; FLJ30473; apoptosis-inducing factor like; FLJ45137
• Gene ID: 150209
• mRNA Refseq: NM_001018060
• Protein Refseq: NP_001018070
• MIM: 617298
• UniProt ID: Q96NN9