Recombinant Human AHSA2 protein, His-tagged

• Cat.No.: AHSA2-5854H
• Product Overview: Recombinant Human AHSA2 protein(163-295 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: N-His
• ProteinLength: 163-295 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIFTVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQKQHFEEIKGSLQLT
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: AHSA2 AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast) [ Homo sapiens ]
• Official Symbol: AHSA2
• Synonyms: AHSA2; AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast); activator of 90 kDa heat shock protein ATPase homolog 2; DKFZp564C236; Hch1; FLJ34679; FLJ41715
• Gene ID: 130872
• mRNA Refseq: NM_152392
• Protein Refseq: NP_689605
• UniProt ID: Q719I0