Recombinant Human AHR

• Cat.No.: AHR-26266TH
• Product Overview: Recombinant fragment corresponding to amino acids 721-820 of Human Aryl hydrocarbon Receptor, with a proprietary tag. Predicted MWt 36.63kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons.
• Molecular Weight: 36.630kDa
• Tissue specificity: Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 PAC (PAS-associated C-terminal) domain.Contains 2 PAS (PER-ARNT-SIM) domains.

Gene Information

• Gene Name: AHR aryl hydrocarbon receptor [ Homo sapiens ]
• Official Symbol: AHR
• Synonyms: AHR; aryl hydrocarbon receptor; bHLHe76
• Gene ID: 196
• mRNA Refseq: NM_001621
• Protein Refseq: NP_001612
• MIM: 600253
• Uniprot ID: P35869
• Chromosome Location: 7p15
• Pathway: Adipogenesis, organism-specific biosystem
• Function: DNA binding; DNA binding; Hsp90 protein binding; ligand-dependent nuclear receptor activity; protein binding