Recombinant Human AHDC1 Protein, GST-tagged

• Cat.No.: AHDC1-458H
• Product Overview: Human AHDC1 full-length ORF ( AAH14394.2, 1 a.a. - 399 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein containing two AT-hooks, which likely function in DNA binding. Mutations in this gene were found in individuals with Xia-Gibbs syndrome. [provided by RefSeq, Jun 2014]
• Molecular Mass: 68.1 kDa
• AA Sequence: MMDWNEASSAPGYNWNQSVLFQSSSKPGRGRRKKVDLFEASHLGFPTSASAAASGYPSKRSTGPRQPRGGRGGGACSAKKERGGAAAKAKFIPKPQPVNPLFQDSPDLGLDYYSGDSSMSPLPSQSRAFGVGERDPCDFIGPYSMNPSTPSDGTFGQGFHCDSPSLGAPELDGKHFPPLAHPPTVFDAGLQKAYSPTCSPTLGFKEELRPPPTKLAACEPLKHGLQGASLGHAAAAQAHLSCRDLPLGQPHYDSPSCKGTAYWYPPGSAARSPPYEGKVGTGLLADFLGRTEAACLSAPHLASPPATPKADKEPLEMARPPGPPRGPAAAAAGYGCPLLSDLTLSPVPRDSLLPLQDTAYRYPGFMPQAHPGLGGGPKSGFLGPMAEPHPEDTFTVTSL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AHDC1 AT-hook DNA binding motif containing 1 [ Homo sapiens (human) ]
• Official Symbol: AHDC1
• Synonyms: AHDC1; AT-hook DNA binding motif containing 1; AT-hook DNA-binding motif-containing protein 1; AT-Hook DNA-Binding Motif-Containing Protein 1; AT Hook, DNA Binding Motif, Containing 1; MRD25
• Gene ID: 27245
• mRNA Refseq: NM_001029882
• Protein Refseq: NP_001025053
• MIM: 615790
• UniProt ID: Q5TGY3