Recombinant Human AGT protein, His-SUMO-tagged
Cat.No. : | AGT-2493H |
Product Overview : | Recombinant Human AGT protein(P01019)(44-427aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 44-427aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 57.9 kDa |
AA Sequence : | VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | AGT angiotensinogen (serpin peptidase inhibitor, clade A, member 8) [ Homo sapiens ] |
Official Symbol | AGT |
Synonyms | AGT; angiotensinogen (serpin peptidase inhibitor, clade A, member 8); SERPINA8; angiotensinogen; alpha 1 antiproteinase; antitrypsin; serpin A8; angiotensin I; angiotensin II; pre-angiotensinogen; alpha-1 antiproteinase, antitrypsin; serine (or cysteine) proteinase inhibitor; ANHU; |
Gene ID | 183 |
mRNA Refseq | NM_000029 |
Protein Refseq | NP_000020 |
UniProt ID | P01019 |
◆ Recombinant Proteins | ||
AGT-293H | Recombinant Human AGT Protein, His (Fc)-Avi-tagged | +Inquiry |
Agt-510R | Recombinant Rat Agt protein, His-tagged | +Inquiry |
Agt-96M | Recombinant Mouse Agt Protein, His-tagged | +Inquiry |
Agt-6860M | Recombinant Mouse Agt protein, His-tagged | +Inquiry |
AGT-0648H | Recombinant Human AGT Protein (Asp34-Ala485), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
AGT-152H | Native Human Angiotensinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGT-2575HCL | Recombinant Human AGT cell lysate | +Inquiry |
AGT-1842MCL | Recombinant Mouse AGT cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGT Products
Required fields are marked with *
My Review for All AGT Products
Required fields are marked with *
0
Inquiry Basket