Recombinant Human AGRP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: AGRP-5468H
• Product Overview: AGRP MS Standard C13 and N15-labeled recombinant protein (NP_001129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes an antagonist of the melanocortin-3 and melanocortin-4 receptor. It appears to regulate hypothalamic control of feeding behavior via melanocortin receptor and/or intracellular calcium regulation, and thus plays a role in weight homeostasis. Mutations in this gene have been associated with late on-set obesity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.4 kDa
• AA Sequence: MLTAAVLSCALLLALPATRGAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: AGRP agouti related neuropeptide [ Homo sapiens (human) ]
• Official Symbol: AGRP
• Synonyms: AGRP; agouti related protein homolog (mouse); agouti (mouse) related protein; agouti-related protein; Agrt; ART; ASIP2; AGRT
• Gene ID: 181
• mRNA Refseq: NM_001138
• Protein Refseq: NP_001129
• MIM: 602311
• UniProt ID: O00253