Recombinant Human AGPS Protein, GST-tagged

• Cat.No.: AGPS-438H
• Product Overview: Human AGPS partial ORF ( NP_003650, 559 a.a. - 658 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the FAD-binding oxidoreductase/transferase type 4 family. It encodes a protein that catalyzes the second step of ether lipid biosynthesis in which acyl-dihydroxyacetonephosphate (DHAP) is converted to alkyl-DHAP by the addition of a long chain alcohol and the removal of a long-chain acid anion. The protein is localized to the inner aspect of the peroxisomal membrane and requires FAD as a cofactor. Mutations in this gene have been associated with rhizomelic chondrodysplasia punctata, type 3 and Zellweger syndrome. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: FAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEAAAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGPS alkylglycerone phosphate synthase [ Homo sapiens (human) ]
• Official Symbol: AGPS
• Synonyms: AGPS; alkylglycerone phosphate synthase; ADAS; ADPS; RCDP3; ADAP-S; ADHAPS; ALDHPSY; alkyldihydroxyacetonephosphate synthase, peroxisomal; aging-associated gene 5 protein; aging-associated protein 5; alkyl-DHAP synthase; EC 2.5.1.26; Alkylglycerone Phosphate Synthase; Aging-Associated Gene 5 Protein; Alkyl-DHAP Synthase; Alkyldihydroxyacetonephosphate Synthase, Peroxisomal; Alkylglycerone-Phosphate Synthase; Aging-Associated Protein 5
• Gene ID: 8540
• mRNA Refseq: NM_003659
• Protein Refseq: NP_003650
• MIM: 603051
• UniProt ID: O00116