Recombinant Human AGPAT2 Protein, GST-tagged

• Cat.No.: AGPAT2-429H
• Product Overview: Human AGPAT2 partial ORF ( NP_006403, 51 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 33.11 kDa
• AA Sequence: RHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGPAT2 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [ Homo sapiens ]
• Official Symbol: AGPAT2
• Synonyms: AGPAT2; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); Berardinelli Seip congenital lipodystrophy, BSCL; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; LPAAT beta; 1-AGPAT 2; 1-AGP acyltransferase 2; lysophosphatidic acid acyltransferase beta; lysophosphatidic acid acyltransferase-beta; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase-beta); BSCL; BSCL1; LPAAB; 1-AGPAT2; LPAAT-beta
• Gene ID: 10555
• mRNA Refseq: NM_001012727
• Protein Refseq: NP_001012745
• MIM: 603100
• UniProt ID: O15120