Recombinant Human AGL protein, His-tagged
Cat.No. : | AGL-4533H |
Product Overview : | Recombinant Human AGL protein(258-424 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 258-424 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | SCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWEFFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPHDKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVTRKHP |
Gene Name | AGL amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase [ Homo sapiens ] |
Official Symbol | AGL |
Synonyms | AGL; amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase; amylo 1, 6 glucosidase, 4 alpha glucanotransferase; glycogen debranching enzyme; glycogen storage disease type III; glycogen debrancher; amylo-1, 6-glucosidase, 4-alpha-glucanotransferase; GDE; |
Gene ID | 178 |
mRNA Refseq | NM_000028 |
Protein Refseq | NP_000019 |
MIM | 610860 |
UniProt ID | P35573 |
◆ Recombinant Proteins | ||
WNT3A-3762H | Recombinant Human WNT3A protein, His-tagged | +Inquiry |
Wnt3a-3763M | Recombinant Mouse Wnt3a protein, His-tagged | +Inquiry |
WNT3A-1700H | Recombinant Human WNT3A | +Inquiry |
Wnt3a-526M | Active Recombinant Murine Wnt3a protein | +Inquiry |
WNT3A-360H | Recombinant Human WNT3A protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT3A-295HCL | Recombinant Human WNT3A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT3A Products
Required fields are marked with *
My Review for All WNT3A Products
Required fields are marked with *
0
Inquiry Basket