Recombinant Human AGER Protein, His-Flag-StrepII-tagged

• Cat.No.: AGER-421P
• Product Overview: Purified AGER (AAH20669.1 23 a.a. - 342 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag&His&Strep II
• Protein Length: 23-342 a.a.
• Description: The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 40.48 kDa
• AA Sequence: AQNITARIGEPLVLKCKGAPKKPPQRLEWNLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 ug/ml
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Gene Information

• Gene Name: AGER advanced glycosylation end product-specific receptor [ Homo sapiens ]
• Official Symbol: AGER
• Synonyms: AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta
• Gene ID: 177
• mRNA Refseq: NM_001136
• Protein Refseq: NP_001127
• MIM: 600214
• UniProt ID: Q15109