Recombinant Human AGER Protein, His-Flag-StrepII-tagged

Cat.No. : AGER-421P
Product Overview : Purified AGER (AAH20669.1 23 a.a. - 342 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Flag&His&Strep II
Protein Length : 23-342 a.a.
Description : The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847). [provided by RefSeq, May 2011]
Form : Liquid
Bio-activity : Not Tested
Molecular Mass : 40.48 kDa
AA Sequence : AQNITARIGEPLVLKCKGAPKKPPQRLEWNLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : ≥ 10 ug/ml
Storage Buffer : 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
Gene Name AGER advanced glycosylation end product-specific receptor [ Homo sapiens ]
Official Symbol AGER
Synonyms AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta;
Gene ID 177
mRNA Refseq NM_001136
Protein Refseq NP_001127
MIM 600214
UniProt ID Q15109

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AGER Products

Required fields are marked with *

My Review for All AGER Products

Required fields are marked with *

0

Inquiry Basket

cartIcon