Recombinant Human RAGE protein, GST-tagged

• Cat.No.: RAGE-2163H
• Product Overview: Recombinant Human RAGE (1-231aa) fussed with GST tag at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Molecular Mass: 53 kDa
• Protein length: 1-231aa
• AA Sequence: MKNYKAIGKIGEGTFSEVMKMQSLRDGNYYACKQMKQRFESIEQVNNLREIQALRRLNPHPNILMLHEVVFDRKS GSLALICELMDMNIYELIRGRRYPLSEKKIMHYMYQLCKSLDHIHRNGIFHRDVKPENILIKQDVLKLGDFGSCR SVYSKQPYTEYISTRWYRAPECLLTDGFYTYKMDLWSAGCVFYEIASLQPLFPGVNELDQISKIHDVIGTPAQKI LTKFKQ
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: AGER advanced glycosylation end product-specific receptor [ Homo sapiens ]
• Official Symbol: AGER
• Synonyms: AGER; advanced glycosylation end product-specific receptor; RAGE; RAGE isoform sRAGE-delta; RAGE isoform NtRAGE-delta
• Gene ID: 177
• mRNA Refseq: NM_001136
• Protein Refseq: NP_001127
• MIM: 600214
• UniProt ID: Q15109
• Chromosome Location: 6p21.3
• Pathway: Activated TLR4 signalling, organism-specific biosystem; Advanced glycosylation endproduct receptor signaling, organism-specific biosystem; Cytosolic sensors of pathogen-associated DNA, organism-specific biosystem; DAI mediated induction of type I IFNs, organism-specific biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; MyD88 cascade initiated on plasma membrane, organism-specific biosystem
• Function: S100 alpha binding; advanced glycation end-product receptor activity; protein binding; receptor activity; receptor activity; transmembrane signaling receptor activity