Recombinant Human AGBL4 Protein, GST-tagged

• Cat.No.: AGBL4-418H
• Product Overview: Human AGBL4 full-length ORF ( ADR83127.1, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AGBL4 (ATP/GTP Binding Protein Like 4) is a Protein Coding gene. Diseases associated with AGBL4 include Macular Degeneration, Age-Related, 1. GO annotations related to this gene include tubulin binding and metallocarboxypeptidase activity. An important paralog of this gene is AGBL5.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 29.5 kDa
• AA Sequence: MDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEACILSPHPALGQPSSSREYPSLTGQELGPQLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGBL4 ATP/GTP binding protein-like 4 [ Homo sapiens ]
• Official Symbol: AGBL4
• Synonyms: AGBL4; ATP/GTP binding protein-like 4; cytosolic carboxypeptidase 6; FLJ14442; ATP/GTP-binding protein-like 4; CCP6
• Gene ID: 84871
• mRNA Refseq: NM_032785
• Protein Refseq: NP_116174
• MIM: 616476
• UniProt ID: Q5VU57