Recombinant Human AGBL4 Protein, GST-tagged

Cat.No. : AGBL4-418H
Product Overview : Human AGBL4 full-length ORF ( ADR83127.1, 1 a.a. - 268 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AGBL4 (ATP/GTP Binding Protein Like 4) is a Protein Coding gene. Diseases associated with AGBL4 include Macular Degeneration, Age-Related, 1. GO annotations related to this gene include tubulin binding and metallocarboxypeptidase activity. An important paralog of this gene is AGBL5.
Molecular Mass : 29.5 kDa
AA Sequence : MDYFFREQLGQSVQQRKLDLLTITSPDNLREGAEQKVVFITGRVHPGETPSSFVCQGIIDFLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLMGFDLNRHWLDPSPWVHPTLHGVKQLIVQMYNDPKTSLEFYIDIHAHSTMMNGFMYGNIFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSYCYTLEVSFYSYIISGTTAAVPYTEEACILSPHPALGQPSSSREYPSLTGQELGPQLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AGBL4 ATP/GTP binding protein-like 4 [ Homo sapiens ]
Official Symbol AGBL4
Synonyms AGBL4; ATP/GTP binding protein-like 4; cytosolic carboxypeptidase 6; FLJ14442; ATP/GTP-binding protein-like 4; CCP6;
Gene ID 84871
mRNA Refseq NM_032785
Protein Refseq NP_116174
MIM 616476
UniProt ID Q5VU57

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AGBL4 Products

Required fields are marked with *

My Review for All AGBL4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon