Recombinant Human AGAP3 protein, GST-tagged
Cat.No. : | AGAP3-2745H |
Product Overview : | Recombinant Human AGAP3 protein(474 - 556 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 474 - 556 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNIFT |
Gene Name | AGAP3 ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [ Homo sapiens ] |
Official Symbol | AGAP3 |
Synonyms | AGAP3; ArfGAP with GTPase domain, ankyrin repeat and PH domain 3; centaurin, gamma 3 , CENTG3; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3; centaurin-gamma-3; centaurin, gamma 3; CRAM-associated GTPase; MR1-interacting protein; CRMP (collapsin response mediator protein) associated; CRAG; AGAP-3; CENTG3; MRIP-1; cnt-g3; FLJ16146; FLJ34452; |
Gene ID | 116988 |
mRNA Refseq | NM_001042535 |
Protein Refseq | NP_001036000 |
UniProt ID | Q96P47 |
◆ Recombinant Proteins | ||
ETV1-244C | Recombinant Cynomolgus Monkey ETV1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Etv1-980M | Recombinant Mouse Etv1 Protein, MYC/DDK-tagged | +Inquiry |
AGAP3-2744H | Recombinant Human AGAP3 protein, His-tagged | +Inquiry |
ETV1-6479C | Recombinant Chicken ETV1 | +Inquiry |
ETV1-1484HFL | Recombinant Full Length Human ETV1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ETV1-6524HCL | Recombinant Human ETV1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ETV1 Products
Required fields are marked with *
My Review for All ETV1 Products
Required fields are marked with *
0
Inquiry Basket