Recombinant Human AGAP3 Protein, GST-Tagged

• Cat.No.: AGAP3-0009H
• Product Overview: Human CENTG3 partial ORF (NP_114152, 241 a.a. - 338 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an essential component of the N-methyl-D-aspartate (NMDA) receptor signaling complex which mediates long-term potentiation in synapses by linking activation of NMDA receptor to alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor trafficking. The encoded protein contains an N-terminal GTPase-like domain, a pleckstrin homology domain, an ArfGAP domain and several C-terminal ankryn repeat domains. [provided by RefSeq, Apr 2017]
• Molecular Mass: 36.52 kDa
• AA Sequence: VFQDVAQKVVALRKKQQLAIGPCKSLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASSTPTPIRKQSKRRSNI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AGAP3 ArfGAP with GTPase domain, ankyrin repeat and PH domain 3 [ Homo sapiens ]
• Official Symbol: AGAP3
• Synonyms: AGAP3; ArfGAP with GTPase domain, ankyrin repeat and PH domain 3; centaurin, gamma 3, CENTG3; arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3; centaurin-gamma-3; centaurin, gamma 3; CRAM-associated GTPase; MR1-interacting protein; CRMP (collapsin response mediator protein) associated; CRAG; AGAP-3; CENTG3; MRIP-1; cnt-g3; FLJ16146; FLJ34452
• Gene ID: 116988
• mRNA Refseq: NM_001042535
• Protein Refseq: NP_001036000
• MIM: 616813
• UniProt ID: Q96P47