Recombinant Human AGA Protein (206-346 aa), His-SUMO-tagged
Cat.No. : | AGA-310H |
Product Overview : | Recombinant Human AGA Protein (206-346 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 206-346 aa |
Description : | Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 31.1 kDa |
AA Sequence : | TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | AGA aspartylglucosaminidase [ Homo sapiens ] |
Official Symbol | AGA |
Synonyms | AGA; aspartylglucosaminidase; ASRG; GA; AGU; |
Gene ID | 175 |
mRNA Refseq | NM_000027 |
Protein Refseq | NP_000018 |
MIM | 613228 |
UniProt ID | P20933 |
◆ Recombinant Proteins | ||
AGA-135H | Active Recombinant Human AGA protein, His-tagged | +Inquiry |
AGA-33C | Recombinant Cynomolgus Monkey AGA Protein, His (Fc)-Avi-tagged | +Inquiry |
AGA-283C | Recombinant Cynomolgus AGA Protein, His-tagged | +Inquiry |
AGA-0650H | Recombinant Human AGA Protein (Pro28-Ala245), His-tagged | +Inquiry |
AGA-555R | Recombinant Rat AGA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGA-784HCL | Recombinant Human AGA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGA Products
Required fields are marked with *
My Review for All AGA Products
Required fields are marked with *
0
Inquiry Basket