Recombinant Human AGA Protein (206-346 aa), His-SUMO-tagged

• Cat.No.: AGA-310H
• Product Overview: Recombinant Human AGA Protein (206-346 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 206-346 aa
• Description: Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 31.1 kDa
• AA Sequence: TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: AGA aspartylglucosaminidase [ Homo sapiens ]
• Official Symbol: AGA
• Synonyms: AGA; aspartylglucosaminidase; ASRG; GA; AGU
• Gene ID: 175
• mRNA Refseq: NM_000027
• Protein Refseq: NP_000018
• MIM: 613228
• UniProt ID: P20933