Recombinant Human AGA Protein (206-346 aa), His-SUMO-tagged

Cat.No. : AGA-310H
Product Overview : Recombinant Human AGA Protein (206-346 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 206-346 aa
Description : Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 31.1 kDa
AA Sequence : TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name AGA aspartylglucosaminidase [ Homo sapiens ]
Official Symbol AGA
Synonyms AGA; aspartylglucosaminidase; ASRG; GA; AGU;
Gene ID 175
mRNA Refseq NM_000027
Protein Refseq NP_000018
MIM 613228
UniProt ID P20933

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AGA Products

Required fields are marked with *

My Review for All AGA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon