Recombinant Human AFF1
Cat.No. : | AFF1-26446TH |
Product Overview : | Recombinant fragment of Human AF4 protein with an N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG |
Sequence Similarities : | Belongs to the AF4 family. |
Gene Name | AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ] |
Official Symbol | AFF1 |
Synonyms | AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2 , PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; |
Gene ID | 4299 |
mRNA Refseq | NM_001166693 |
Protein Refseq | NP_001160165 |
MIM | 159557 |
Uniprot ID | P51825 |
Chromosome Location | 4q21.3 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
Aff1-3230M | Recombinant Mouse Aff1, His-tagged | +Inquiry |
AFF1-405H | Recombinant Human AFF1 Protein, GST-tagged | +Inquiry |
AFF1-1732H | Recombinant Human AFF1 protein, His & T7-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFF1 Products
Required fields are marked with *
My Review for All AFF1 Products
Required fields are marked with *
0
Inquiry Basket