Recombinant Human AFF1
| Cat.No. : | AFF1-26446TH |
| Product Overview : | Recombinant fragment of Human AF4 protein with an N terminal proprietary tag; Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Protein length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | LSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPASGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFG |
| Sequence Similarities : | Belongs to the AF4 family. |
| Tag : | Non |
| Gene Name | AFF1 AF4/FMR2 family, member 1 [ Homo sapiens ] |
| Official Symbol | AFF1 |
| Synonyms | AFF1; AF4/FMR2 family, member 1; MLLT2, myeloid/lymphoid or mixed lineage leukemia (trithorax (Drosophila) homolog); translocated to, 2 , PBM1, pre B cell monocytic leukemia partner 1; AF4/FMR2 family member 1; AF 4; AF4; |
| Gene ID | 4299 |
| mRNA Refseq | NM_001166693 |
| Protein Refseq | NP_001160165 |
| MIM | 159557 |
| Uniprot ID | P51825 |
| Chromosome Location | 4q21.3 |
| Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
| Function | sequence-specific DNA binding transcription factor activity; |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AFF1 Products
Required fields are marked with *
My Review for All AFF1 Products
Required fields are marked with *
0
Inquiry Basket
