Recombinant Human AEBP2 Protein, GST-tagged

Cat.No. : AEBP2-395H
Product Overview : Human AEBP2 full-length ORF ( NP_694939.1, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AEBP2 (AE Binding Protein 2) is a Protein Coding gene. Diseases associated with AEBP2 include Waardenburg Syndrome, Type 4A. Among its related pathways are Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 and Chromatin organization. GO annotations related to this gene include RNA polymerase II core promoter proximal region sequence-specific DNA binding and transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding.
Molecular Mass : 59.4 kDa
AA Sequence : MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AEBP2 AE binding protein 2 [ Homo sapiens ]
Official Symbol AEBP2
Synonyms AEBP2; AE binding protein 2; zinc finger protein AEBP2; MGC17922; AE-binding protein 2; adipocyte enhancer-binding protein 2; AE(adipocyte enhancer)-binding protein 2;
Gene ID 121536
mRNA Refseq NM_001114176
Protein Refseq NP_001107648
UniProt ID Q6ZN18

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AEBP2 Products

Required fields are marked with *

My Review for All AEBP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon