Recombinant Human AEBP2 Protein, GST-tagged

Description :	This gene encodes a member of carboxypeptidase A protein family. The encoded protein may function as a transcriptional repressor and play a role in adipogenesis and smooth muscle cell differentiation. Studies in mice suggest that this gene functions in wound healing and abdominal wall development. Overexpression of this gene is associated with glioblastoma. [provided by RefSeq, May 2013]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.96 kDa
AA Sequence :	VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	AEBP1 AE binding protein 1 [ Homo sapiens ]
Official Symbol	AEBP1
Synonyms	AEBP1; AE binding protein 1; adipocyte enhancer-binding protein 1; ACLP; adipocyte enhancer binding protein 1; aortic carboxypeptidase like protein; AE-binding protein 1; aortic carboxypeptidase-like protein; FLJ33612;
Gene ID	165
mRNA Refseq	NM_001129
Protein Refseq	NP_001120
MIM	602981
UniProt ID	Q8IUX7