Recombinant Human AEBP2 Protein, GST-tagged

Cat.No. : AEBP1-394H
Product Overview : Human AEBP1 partial ORF ( NP_001120, 912 a.a. - 1013 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of carboxypeptidase A protein family. The encoded protein may function as a transcriptional repressor and play a role in adipogenesis and smooth muscle cell differentiation. Studies in mice suggest that this gene functions in wound healing and abdominal wall development. Overexpression of this gene is associated with glioblastoma. [provided by RefSeq, May 2013]
Molecular Mass : 36.96 kDa
AA Sequence : VTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAKTCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AEBP1 AE binding protein 1 [ Homo sapiens ]
Official Symbol AEBP1
Synonyms AEBP1; AE binding protein 1; adipocyte enhancer-binding protein 1; ACLP; adipocyte enhancer binding protein 1; aortic carboxypeptidase like protein; AE-binding protein 1; aortic carboxypeptidase-like protein; FLJ33612;
Gene ID 165
mRNA Refseq NM_001129
Protein Refseq NP_001120
MIM 602981
UniProt ID Q8IUX7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All AEBP1 Products

Required fields are marked with *

My Review for All AEBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon