Recombinant Human ADRA1A protein(351-420 aa), C-His-tagged
Cat.No. : | ADRA1A-2736H |
Product Overview : | Recombinant Human ADRA1A protein(P35348)(351-420 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 351-420 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT |
Gene Name | ADRA1A adrenergic, alpha-1A-, receptor [ Homo sapiens ] |
Official Symbol | ADRA1A |
Synonyms | ADRA1A; adrenergic, alpha-1A-, receptor; ADRA1C; alpha-1A adrenergic receptor; ADRA1L1; alpha-1A adrenoceptor; alpha-1A adrenoreceptor; G protein coupled receptor; alpha-1C adrenergic receptor; adrenergic, alpha-1A-, receptor variant 1; adrenergic, alpha-1A-, receptor variant 3; adrenergic, alpha-1A-, receptor variant 5; adrenergic, alpha-1A-, receptor variant 8; ALPHA1AAR; |
Gene ID | 148 |
mRNA Refseq | NM_000680 |
Protein Refseq | NP_000671 |
MIM | 104221 |
UniProt ID | P35348 |
◆ Recombinant Proteins | ||
RFL-36017RF | Recombinant Full Length Rat Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged | +Inquiry |
ADRA1A-539R | Recombinant Rat ADRA1A Protein | +Inquiry |
ADRA1A-0570H | Recombinant Human ADRA1A Protein (Ser330-Val466), N-His-tagged | +Inquiry |
RFL-301HF | Recombinant Full Length Human Alpha-1A Adrenergic Receptor(Adra1A) Protein, His-Tagged | +Inquiry |
ADRA1A-378H | Recombinant Human ADRA1A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADRA1A Products
Required fields are marked with *
My Review for All ADRA1A Products
Required fields are marked with *
0
Inquiry Basket