Recombinant Human ADRA1A protein(351-420 aa), C-His-tagged

• Cat.No.: ADRA1A-2736H
• Product Overview: Recombinant Human ADRA1A protein(P35348)(351-420 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 351-420 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: SSKHALGYTLHPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: ADRA1A adrenergic, alpha-1A-, receptor [ Homo sapiens ]
• Official Symbol: ADRA1A
• Synonyms: ADRA1A; adrenergic, alpha-1A-, receptor; ADRA1C; alpha-1A adrenergic receptor; ADRA1L1; alpha-1A adrenoceptor; alpha-1A adrenoreceptor; G protein coupled receptor; alpha-1C adrenergic receptor; adrenergic, alpha-1A-, receptor variant 1; adrenergic, alpha-1A-, receptor variant 3; adrenergic, alpha-1A-, receptor variant 5; adrenergic, alpha-1A-, receptor variant 8; ALPHA1AAR
• Gene ID: 148
• mRNA Refseq: NM_000680
• Protein Refseq: NP_000671
• MIM: 104221
• UniProt ID: P35348